Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 6D-41 IGKV6D-41

UniProt

A0A0C4DH26

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR1A2 Adenovirus (Human)
34983051 1.0 mL

OR1A2 Adenovirus (Human)

Sign In for Pricing
View Details
Bcl-2 (Apoptosis regulator Bcl-2, B Cell CLL/lymphoma-2) (MaxLight 405) discontinued
138498-AF-ML405 100 µL

Bcl-2 (Apoptosis regulator Bcl-2, B Cell CLL/lymphoma-2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-GAL Polyclonal Antibody
TMAB-06276-01 50 μL

Anti-GAL Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GAL Polyclonal Antibody
TMAB-06276-02 100 µL

Anti-GAL Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GAL Polyclonal Antibody
TMAB-06276-03 200 µL

Anti-GAL Polyclonal Antibody

Sign In for Pricing
View Details
POLd (Polymerase DNA Directed Delta 1, CDC2, POLD1, DNA polymerase subunit delta p125)
364709 200 µL

POLd (Polymerase DNA Directed Delta 1, CDC2, POLD1, DNA polymerase subunit delta p125)

Sign In for Pricing
View Details