Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 8 (TRGV8), Biotinylated

This Recombinant Human T cell receptor gamma variable 8 (TRGV8), Biotinylated spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 8 TRGV8 TCRGV8

UniProt

A0A0C4DH27

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVTRPTGSSAVITCDLPVENAVYTHWYLHQEGKAPQRLLYYDSYNSRVVLESGISREKYHTYASTGKSLKFILENLIERDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pECMV-Bcmo1-m-FLAG Plasmid
PVT14940 2 µg

pECMV-Bcmo1-m-FLAG Plasmid

Sign In for Pricing
View Details
DMPK ELISA Kit (Human) (OKEH08193)
OKEH08193 96 Well

DMPK ELISA Kit (Human) (OKEH08193)

Sign In for Pricing
View Details
Ankrd58 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7159608 1.0 µg DNA

Ankrd58 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
1-[3- (Aminomethyl) pyridin-2-yl]piperidine-4-carboxamide
DNB74590-01 100 mg

1-[3- (Aminomethyl) pyridin-2-yl]piperidine-4-carboxamide

Sign In for Pricing
View Details
1-[3- (Aminomethyl) pyridin-2-yl]piperidine-4-carboxamide
DNB74590-02 1 g

1-[3- (Aminomethyl) pyridin-2-yl]piperidine-4-carboxamide

Sign In for Pricing
View Details
TRPV3 Protein Vector (Rat) (pPB-C-His)
PV313198 500 ng

TRPV3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details