Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-3 (HV103), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-3 (HV103), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-3 IGHV1-3

UniProt

A0A0C4DH29

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX10 (NM_013322) Human Recombinant Protein
TP306019 20 µg

SNX10 (NM_013322) Human Recombinant Protein

Sign In for Pricing
View Details
Abridin
TRC-A109045-50MG 50 mg

Abridin

Sign In for Pricing
View Details
ITM2A Mouse Monoclonal Antibody [Clone ID: OTI10C11]
CF811876 100 µg

ITM2A Mouse Monoclonal Antibody [Clone ID: OTI10C11]

Sign In for Pricing
View Details
DOG-1 (DG1/447), CF405S conjugate, 0.1mg/mL
BNC040447-500 1x 500 µL

DOG-1 (DG1/447), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(Z)-10-Tritriacontene
TRC-T456820-250MG 250 mg

(Z)-10-Tritriacontene

Sign In for Pricing
View Details
Direct Black 168 (tech grade)
TRC-D494820-50MG 50 mg

Direct Black 168 (tech grade)

Sign In for Pricing
View Details