Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actg1 Mouse Gene Knockout Kit (CRISPR)
KN500775 1 Kit

Actg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Human Gene Knockout Kit (CRISPR)
KN416029 1 Kit

Myeloperoxidase (MPO) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glutathione S-Transferase Mu2 (GSTM2) (CPTC-GSTMu2-2), CF640R conjugate, 0.1mg/mL
BNC402242-500 1x 500 µL

Glutathione S-Transferase Mu2 (GSTM2) (CPTC-GSTMu2-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ephexin 1 (NGEF) (NM_019850) Human Recombinant Protein
TP306775M 100 µg

Ephexin 1 (NGEF) (NM_019850) Human Recombinant Protein

Sign In for Pricing
View Details
CEMP1 Human Gene Knockout Kit (CRISPR)
KN415622 1 Kit

CEMP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Amino-4-fluoro-5-nitrobenzoic Acid
TRC-A632455-10MG 10 mg

2-Amino-4-fluoro-5-nitrobenzoic Acid

Sign In for Pricing
View Details