Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-24 (HV124), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-24 IGHV1-24

UniProt

A0A0C4DH33

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELSMHWVRQAPGKGLEWMGGFDPEDGETIYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Argonaute 2 (N-terminus) Antibody
MBS474180-01 0.1 mL

Argonaute 2 (N-terminus) Antibody

Sign In for Pricing
View Details
Argonaute 2 (N-terminus) Antibody
MBS474180-02 5x 0.1 mL

Argonaute 2 (N-terminus) Antibody

Sign In for Pricing
View Details
Calr3 (NM_029782) Mouse Tagged ORF Clone
MR218700 10 µg

Calr3 (NM_029782) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NDUFA3 Polyclonal Antibody
A71363-100 100 µL

NDUFA3 Polyclonal Antibody

Sign In for Pricing
View Details
Kazrin (KAZN) CytoSection
TS413541P5 25 Slides

Kazrin (KAZN) CytoSection

Sign In for Pricing
View Details
PDHB (NM_001173468) Human Over-expression Lysate
LH00519V 100 µg

PDHB (NM_001173468) Human Over-expression Lysate

Sign In for Pricing
View Details