Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM71E1 Human qPCR Primer Pair (NM_138411)
HP216966 200 Reactions

FAM71E1 Human qPCR Primer Pair (NM_138411)

Sign In for Pricing
View Details
TAS2R42 (NM_181429) Human Tagged Lenti ORF Clone
RC221352L3 10 µg

TAS2R42 (NM_181429) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rangap1 Mouse shRNA Plasmid (Locus ID 19387)
TL513784 1 Kit

Rangap1 Mouse shRNA Plasmid (Locus ID 19387)

Sign In for Pricing
View Details
Human STIP1 Homology And U-Box Containing Protein 1 (STUB1) ELISA Kit
BSKH66206-01 48 Tests

Human STIP1 Homology And U-Box Containing Protein 1 (STUB1) ELISA Kit

Sign In for Pricing
View Details
Human STIP1 Homology And U-Box Containing Protein 1 (STUB1) ELISA Kit
BSKH66206-02 96 Tests

Human STIP1 Homology And U-Box Containing Protein 1 (STUB1) ELISA Kit

Sign In for Pricing
View Details
N- (2,4-Dimethylphenyl) -2-[5- (4-methylphenyl) -4,6-dioxo-4,5,6,6a-tetrahydropyrrolo[3,4-d][1,2,3]triazol-1 (3aH) -yl]acetamide
sc-493609 5 mg

N- (2,4-Dimethylphenyl) -2-[5- (4-methylphenyl) -4,6-dioxo-4,5,6,6a-tetrahydropyrrolo[3,4-d][1,2,3]triazol-1 (3aH) -yl]acetamide

Sign In for Pricing
View Details