Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Histone H3 [ac Lys18] Antibody [Alexa Fluor 647]
NB21-1144AF647 0.05 mL

Rabbit Polyclonal Histone H3 [ac Lys18] Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Bovine N-Terminal Pro Atrial Natriuretic Peptide ELISA
GTR10377595 96 Well

Bovine N-Terminal Pro Atrial Natriuretic Peptide ELISA

Sign In for Pricing
View Details
CD105 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-4609R-BF350-TR 20 µL

CD105 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
AGPHD1 Rabbit Polyclonal Antibody
E28PN7932 100 µL

AGPHD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hagh sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3204404 1.0 µg DNA

Hagh sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Shewanella baltica Triosephosphate isomerase (tpiA)
MBS1075380-01 0.05 mg (E-Coli)

Recombinant Shewanella baltica Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details