Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-38 (HV338), Biotinylated spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-38 IGHV3-38

UniProt

A0A0C4DH36

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAPGKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NSUN2 shRNA Plasmid
abx973964-01 150 µg

Mouse NSUN2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse NSUN2 shRNA Plasmid
abx973964-02 300 µg

Mouse NSUN2 shRNA Plasmid

Sign In for Pricing
View Details
Rat Krt73 Pre-designed siRNA Set B
SI207416B 1 Each

Rat Krt73 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ORAI2 Rabbit Polyclonal Antibody (Biotin)
orb2112103 100 µL

ORAI2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
N-Desmethyl-6-O-methylerythromycin (9E) -Oxime
458842-01 5 mg

N-Desmethyl-6-O-methylerythromycin (9E) -Oxime

Sign In for Pricing
View Details
N-Desmethyl-6-O-methylerythromycin (9E) -Oxime
458842-02 50 mg

N-Desmethyl-6-O-methylerythromycin (9E) -Oxime

Sign In for Pricing
View Details