Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF594 conjugate, 0.1mg/mL
BNC941948-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human AHA1 (AHSA1) (NM_012111) AAV Particle
RC201782A1V 250 µL

Human AHA1 (AHSA1) (NM_012111) AAV Particle

Sign In for Pricing
View Details
MON1A Antibody
orb1249173 0.1 mg

MON1A Antibody

Sign In for Pricing
View Details
AIFM2 Rabbit pAb, PE-Cy5.5 conjugated
orb2848274 100 µL

AIFM2 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
TS (C-5) FITC
sc-390945 FITC 200 µg/mL

TS (C-5) FITC

Sign In for Pricing
View Details
PICALM (Phosphatidylinositol-Binding Clathrin Assembly Protein, Clathrin Assembly lymphoid Myeloid Leukemia Protein, PICALM, CALM) (MaxLight 750)
MBS6458140-01 0.1 mL

PICALM (Phosphatidylinositol-Binding Clathrin Assembly Protein, Clathrin Assembly lymphoid Myeloid Leukemia Protein, PICALM, CALM) (MaxLight 750)

Sign In for Pricing
View Details