Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf6 (AC1, Uncharacterized Protein C4orf6, Protein AC1) (AP)
MBS6130290-01 0.1 mL

C4orf6 (AC1, Uncharacterized Protein C4orf6, Protein AC1) (AP)

Sign In for Pricing
View Details
C4orf6 (AC1, Uncharacterized Protein C4orf6, Protein AC1) (AP)
MBS6130290-02 5x 0.1 mL

C4orf6 (AC1, Uncharacterized Protein C4orf6, Protein AC1) (AP)

Sign In for Pricing
View Details
Anti-HER2/ERBB2 Antibody Picoband® (Biotine Conjugate)
A00010-5-Biotin 100 µg/Vial

Anti-HER2/ERBB2 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Human DNAM-1 Protein, mFc-His Tag
orb689406-01 10 µg

Human DNAM-1 Protein, mFc-His Tag

Sign In for Pricing
View Details
Human DNAM-1 Protein, mFc-His Tag
orb689406-02 50 µg

Human DNAM-1 Protein, mFc-His Tag

Sign In for Pricing
View Details
Human DNAM-1 Protein, mFc-His Tag
orb689406-03 100 µg

Human DNAM-1 Protein, mFc-His Tag

Sign In for Pricing
View Details