Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-58 (HV158), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-58 (HV158), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-58 IGHV1-58

UniProt

A0A0C4DH39

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP4B Recombinant Antibody, PE-Cy7 Conjugated
bsm-61303R-PE-Cy7-TR 20 µL

INPP4B Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
T3 AccuBind ELISA Kit
125-300B 192 Well

T3 AccuBind ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Integral membrane protein 2B
E2822h 96 Tests

ELISA Kit For Integral membrane protein 2B

Sign In for Pricing
View Details
ROCK2 Rabbit pAb, PerCP-Cy7 conjugated
orb2851371 100 µL

ROCK2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
V5-Tag Antibody
MBS850504-01 0.2 mL

V5-Tag Antibody

Sign In for Pricing
View Details
V5-Tag Antibody
MBS850504-02 0.1 mL (AF405L)

V5-Tag Antibody

Sign In for Pricing
View Details