Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC eta (PRKCH) Rabbit Polyclonal Antibody
TA385052 100 µL

PKC eta (PRKCH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF594 conjugate, 0.1mg/mL
BNC940844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAFB (NM_005461) Human Over-expression Lysate
LY401676 100 µg

MAFB (NM_005461) Human Over-expression Lysate

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (rADFP/1493), CF568 conjugate, 0.1mg/mL
BNC683185-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (rADFP/1493), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CAPS2 Human Gene Knockout Kit (CRISPR)
KN415101 1 Kit

CAPS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF568 conjugate, 0.1mg/mL
BNC681138-100 1x 100 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details