Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-61 (HV461), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-61 (HV461), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-61 IGHV4-61

UniProt

A0A0C4DH41

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HHLA3 activation kit by CRISPRa
GA107670 1 Kit

Human HHLA3 activation kit by CRISPRa

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), 0.2mg/mL
BNUB1967-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), 0.2mg/mL

Sign In for Pricing
View Details
TCEP-d12 Hydrochloride
TRC-T012502-10MG 10 mg

TCEP-d12 Hydrochloride

Sign In for Pricing
View Details
Mouse VEGF164, Tag Free
HA210780-01 20 µg

Mouse VEGF164, Tag Free

Sign In for Pricing
View Details
Mouse VEGF164, Tag Free
HA210780-02 50 µg

Mouse VEGF164, Tag Free

Sign In for Pricing
View Details
Mouse VEGF164, Tag Free
HA210780-03 100 µg

Mouse VEGF164, Tag Free

Sign In for Pricing
View Details