Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-66 (HV366), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-66 (HV366), Biotinylated spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-66 IGHV3-66

UniProt

A0A0C4DH42

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSCGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP26A1 (NM_000783) Human Tagged ORF Clone
RG216278 10 µg

CYP26A1 (NM_000783) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lrpap1 (NM_013587) Mouse Untagged Clone
MC208899 10 µg

Lrpap1 (NM_013587) Mouse Untagged Clone

Sign In for Pricing
View Details
FUT4 Mouse Monoclonal Antibody (BF647)
orb2369175 100 µL

FUT4 Mouse Monoclonal Antibody (BF647)

Sign In for Pricing
View Details
Anti-MTMR3 Antibody Picoband® Fluoro594 Conjugated
A05937-1-Fluoro594 100 µg/Vial

Anti-MTMR3 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Human DHTKD1 Protein Lysate
MBS8410509-01 0.02 mg

Human DHTKD1 Protein Lysate

Sign In for Pricing
View Details
Human DHTKD1 Protein Lysate
MBS8410509-02 5x 0.02 mg

Human DHTKD1 Protein Lysate

Sign In for Pricing
View Details