Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus Aureus MW0072 Protein (aa 25-256)
VAng-Cr5975-500gEcoli 500 µg (E. coli)

Recombinant Staphylococcus Aureus MW0072 Protein (aa 25-256)

Sign In for Pricing
View Details
AHR antagonist 2
MBS5766014 Inquire

AHR antagonist 2

Sign In for Pricing
View Details
Human DRAM1/DNA damage-regulated autophagy modulator protein 1 ELISA Kit
E0731Hu 96 Tests

Human DRAM1/DNA damage-regulated autophagy modulator protein 1 ELISA Kit

Sign In for Pricing
View Details
IBPL1 Polyclonal Antibody
E44H09365 100 µL

IBPL1 Polyclonal Antibody

Sign In for Pricing
View Details
PEX10 3'UTR GFP Stable Cell Line
TU067749 1.0 mL

PEX10 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ammifurin
T30002-01 100 mg

Ammifurin

Sign In for Pricing
View Details