Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

W/W027/NL337/TWM-297X420-1 Electrical & Equipment Safety Signs & Labels (Adhesive)
237307 1 Pack (1 Panel (s) x 1 Pack)

W/W027/NL337/TWM-297X420-1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
G protein alpha inhibitor 1 (GNAI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]
TA811907AM 100 µL

G protein alpha inhibitor 1 (GNAI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]

Sign In for Pricing
View Details
ACL Assay Kit
E47S483U 50 Tests - 48 Samples

ACL Assay Kit

Sign In for Pricing
View Details
ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 490)
MBS6201332-01 0.1 mL

ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 490)

Sign In for Pricing
View Details
ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 490)
MBS6201332-02 5x 0.1 mL

ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) (MaxLight 490)

Sign In for Pricing
View Details
DRD3 Antibody
MBS1492992-01 0.05 mL

DRD3 Antibody

Sign In for Pricing
View Details