Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK6 Rabbit Polyclonal Antibody (Cy3)
orb989619 100 µL

KLK6 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Sodium Acetate Anhydrous ExiPlus, Multi-Compendial, 99%
51483 500 g

Sodium Acetate Anhydrous ExiPlus, Multi-Compendial, 99%

Sign In for Pricing
View Details
Rat Patz1 Pre-designed siRNA Set B
SI210093B 1 Each

Rat Patz1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Urocanase Domain Containing Protein 1 (UROC1)
TRV-0054778-01 10 µg

Recombinant Urocanase Domain Containing Protein 1 (UROC1)

Sign In for Pricing
View Details
Recombinant Urocanase Domain Containing Protein 1 (UROC1)
TRV-0054778-02 50 µg

Recombinant Urocanase Domain Containing Protein 1 (UROC1)

Sign In for Pricing
View Details
Recombinant Urocanase Domain Containing Protein 1 (UROC1)
TRV-0054778-03 100 µg

Recombinant Urocanase Domain Containing Protein 1 (UROC1)

Sign In for Pricing
View Details