Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-4 (TVB54), Biotinylated

This Recombinant Human T cell receptor beta variable 5-4 (TVB54), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-4 TRBV5-4

UniProt

A0A0C4DH59

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSSQSGHNTVSWYQQALGQGPQFIFQYYREEENGRGNFPPRFSGLQFPNYSSELNVNALELDDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyruvate Kinase, Liver And RBC (PKLR) Antibody
abx236490 100 µg

Pyruvate Kinase, Liver And RBC (PKLR) Antibody

Sign In for Pricing
View Details
Thyroid Peroxidase, Recombinant, Human (TPO, TMA, Thyroid Microsomal Antigen)
T5399-04R 20 µg

Thyroid Peroxidase, Recombinant, Human (TPO, TMA, Thyroid Microsomal Antigen)

Sign In for Pricing
View Details
SYMPK Rabbit Polyclonal Antibody (HRP)
orb2121521 100 µL

SYMPK Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MIPEP Polyclonal Antibody
MBS9431617-01 0.05 mL

MIPEP Polyclonal Antibody

Sign In for Pricing
View Details
MIPEP Polyclonal Antibody
MBS9431617-02 0.1 mL

MIPEP Polyclonal Antibody

Sign In for Pricing
View Details
MIPEP Polyclonal Antibody
MBS9431617-03 5x 0.1 mL

MIPEP Polyclonal Antibody

Sign In for Pricing
View Details