Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Leptin Receptor (LEPR) Monoclonal antibody
FY-AB34375-01 1 mL

Anti-Leptin Receptor (LEPR) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Leptin Receptor (LEPR) Monoclonal antibody
FY-AB34375-02 100 µL

Anti-Leptin Receptor (LEPR) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Leptin Receptor (LEPR) Monoclonal antibody
FY-AB34375-03 200 µL

Anti-Leptin Receptor (LEPR) Monoclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) WOX13 Polyclonal Antibody
MBS7167784 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) WOX13 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit gamma (PIK3C2G) ELISA Kit
abx537490 96 Tests

Mouse Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit gamma (PIK3C2G) ELISA Kit

Sign In for Pricing
View Details
Beta-Sitosterol (Standard)
HY-N0171R-01 5 mg

Beta-Sitosterol (Standard)

Sign In for Pricing
View Details