Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf49B (NM_001145139) Human Over-expression Lysate
LC428718 20 µg

CXorf49B (NM_001145139) Human Over-expression Lysate

Sign In for Pricing
View Details
NELF (NSMF) (NM_001178064) Human Over-expression Lysate
LY433183 100 µg

NELF (NSMF) (NM_001178064) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin D2 (CCND2/2620), CF640R conjugate, 0.1mg/mL
BNC402620-500 1x 500 µL

Cyclin D2 (CCND2/2620), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin Polyclonal Antibody
E-AB-40571-01 25 µL

Desmin Polyclonal Antibody

Sign In for Pricing
View Details
Desmin Polyclonal Antibody
E-AB-40571-02 100 µL

Desmin Polyclonal Antibody

Sign In for Pricing
View Details
L-Valine Benzyl Ester
TRC-V094270-500MG 500 mg

L-Valine Benzyl Ester

Sign In for Pricing
View Details