Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protein kinase A (PKA) ELISA Kit
201-11-3379 96 Tests

Rat Protein kinase A (PKA) ELISA Kit

Sign In for Pricing
View Details
Trim44 siRNA Oligos set (Rat)
47790176 3x 5 nmol

Trim44 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (MaxLight 750)
MBS6236149-01 0.1 mL

XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (MaxLight 750)

Sign In for Pricing
View Details
XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (MaxLight 750)
MBS6236149-02 5x 0.1 mL

XRCC2 (X-ray Repair Cross-complementing Protein 2, DNA Repair Protein XRCC2) (MaxLight 750)

Sign In for Pricing
View Details
Vmn1r43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3810507 1.0 µg DNA

Vmn1r43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Monoclonal CD27/TNFRSF7 Antibody (012) [Alexa Fluor 488]
NBP2-90423AF488 0.1 mL

Rabbit Monoclonal CD27/TNFRSF7 Antibody (012) [Alexa Fluor 488]

Sign In for Pricing
View Details