Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-6 (KV106), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-6 (KV106), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-6 IGKV1-6

UniProt

A0A0C4DH72

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt1 Polyclonal Antibody
E20-70184 100 µg

Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit AN1-type zinc finger and ubiquitin domain-containing protein 1 (ANUBL1) ELISA Kit
MBS7217776-01 48 Well

Rabbit AN1-type zinc finger and ubiquitin domain-containing protein 1 (ANUBL1) ELISA Kit

Sign In for Pricing
View Details
Rabbit AN1-type zinc finger and ubiquitin domain-containing protein 1 (ANUBL1) ELISA Kit
MBS7217776-02 96 Well

Rabbit AN1-type zinc finger and ubiquitin domain-containing protein 1 (ANUBL1) ELISA Kit

Sign In for Pricing
View Details
Rabbit AN1-type zinc finger and ubiquitin domain-containing protein 1 (ANUBL1) ELISA Kit
MBS7217776-03 5x 96 Well

Rabbit AN1-type zinc finger and ubiquitin domain-containing protein 1 (ANUBL1) ELISA Kit

Sign In for Pricing
View Details
Rabbit AN1-type zinc finger and ubiquitin domain-containing protein 1 (ANUBL1) ELISA Kit
MBS7217776-04 10x 96 Well

Rabbit AN1-type zinc finger and ubiquitin domain-containing protein 1 (ANUBL1) ELISA Kit

Sign In for Pricing
View Details
Active Recombinant Mouse Cpb1 protein, His-tagged
Cpb1-3286M 10 µg

Active Recombinant Mouse Cpb1 protein, His-tagged

Sign In for Pricing
View Details