Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-12 (KV112), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-12 (KV112), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-12 IGKV1-12

UniProt

A0A0C4DH73

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), 0.2mg/mL
BNUB1819-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), 0.2mg/mL

Sign In for Pricing
View Details
4-[4-[(3-Aminopropyl)amino]phenyl]-3-morpholinone
TRC-A629315-50MG 50 mg

4-[4-[(3-Aminopropyl)amino]phenyl]-3-morpholinone

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF568 conjugate, 0.1mg/mL
BNC682923-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Diisopropylaminoethyl Chloride Hydrochloride-d14
TRC-D455424-2.5MG 2.5 mg

2-Diisopropylaminoethyl Chloride Hydrochloride-d14

Sign In for Pricing
View Details
LONRF2 Antibody
KC-18240-01 50 μL

LONRF2 Antibody

Sign In for Pricing
View Details
LONRF2 Antibody
KC-18240-02 100 µL

LONRF2 Antibody

Sign In for Pricing
View Details