Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-12 (KV112), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-12 (KV112), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-12 IGKV1-12

UniProt

A0A0C4DH73

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC7A4 shRNA Plasmid
abx954437-01 150 µg

Human SLC7A4 shRNA Plasmid

Sign In for Pricing
View Details
Human SLC7A4 shRNA Plasmid
abx954437-02 300 µg

Human SLC7A4 shRNA Plasmid

Sign In for Pricing
View Details
Colnelenic acid
HY-166261 1 Each

Colnelenic acid

Sign In for Pricing
View Details
Anti-Human CD367/CLEC4A Antibody (9E8#), APC
FHJ94913 100 Tests

Anti-Human CD367/CLEC4A Antibody (9E8#), APC

Sign In for Pricing
View Details
OSBPL11, NT (OSBPL11, ORP11, OSBP12, Oxysterol-binding protein-related protein 11) (MaxLight 405)
MBS6329696-01 0.1 mL

OSBPL11, NT (OSBPL11, ORP11, OSBP12, Oxysterol-binding protein-related protein 11) (MaxLight 405)

Sign In for Pricing
View Details
OSBPL11, NT (OSBPL11, ORP11, OSBP12, Oxysterol-binding protein-related protein 11) (MaxLight 405)
MBS6329696-02 5x 0.1 mL

OSBPL11, NT (OSBPL11, ORP11, OSBP12, Oxysterol-binding protein-related protein 11) (MaxLight 405)

Sign In for Pricing
View Details