Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-39 (LV539), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-39 (LV539), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-39 IGLV5-39

UniProt

A0A0G2JS06

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPTSLSASPGASARFTCTLRSGINVGTYRIYWYQQKPGSLPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYSSTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD62L/SELL Antibody Picoband® (Dylight594 Conjugate)
A00652-Dylight594 100 µg

Anti-CD62L/SELL Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
PDS5A, CT (PDS5A, KIAA0648, PDS5, Sister chromatid cohesion protein PDS5 homolog A, Cell proliferation-inducing gene 54 protein, Sister chromatid cohesion protein 112) (PE) discontinued
039856-PE 200 µL

PDS5A, CT (PDS5A, KIAA0648, PDS5, Sister chromatid cohesion protein PDS5 homolog A, Cell proliferation-inducing gene 54 protein, Sister chromatid cohesion protein 112) (PE) discontinued

Sign In for Pricing
View Details
Biotin Anti-Mouse CD11c (N418)
MBS4165339-01 0.1 mg

Biotin Anti-Mouse CD11c (N418)

Sign In for Pricing
View Details
Biotin Anti-Mouse CD11c (N418)
MBS4165339-02 5x 0.1 mg

Biotin Anti-Mouse CD11c (N418)

Sign In for Pricing
View Details
UTP23 cDNA Clone
MBS1276024-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

UTP23 cDNA Clone

Sign In for Pricing
View Details
UTP23 cDNA Clone
MBS1276024-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

UTP23 cDNA Clone

Sign In for Pricing
View Details