Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-39 (LV539), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-39 (LV539), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-39 IGLV5-39

UniProt

A0A0G2JS06

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPTSLSASPGASARFTCTLRSGINVGTYRIYWYQQKPGSLPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYSSTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Mouse CD45.2 Antibody
RD21536F-01 25 µg

PE/Cyanine5 Anti-Mouse CD45.2 Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD45.2 Antibody
RD21536F-02 100 µg

PE/Cyanine5 Anti-Mouse CD45.2 Antibody

Sign In for Pricing
View Details
Olfr270 CRISPR/Cas9 KO Plasmid (m)
sc-434729 20 µg

Olfr270 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
1,3-Dibromo-5- (4-fluorobenzyl) benzene
PC1012408 250 mg

1,3-Dibromo-5- (4-fluorobenzyl) benzene

Sign In for Pricing
View Details
7-Bromobenzo[d]isoxazol-3-amine
OR94774-01 250 mg

7-Bromobenzo[d]isoxazol-3-amine

Sign In for Pricing
View Details
7-Bromobenzo[d]isoxazol-3-amine
OR94774-02 1 g

7-Bromobenzo[d]isoxazol-3-amine

Sign In for Pricing
View Details