Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-39 (LV539), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-39 (LV539), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-39 IGLV5-39

UniProt

A0A0G2JS06

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPTSLSASPGASARFTCTLRSGINVGTYRIYWYQQKPGSLPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYSSTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Azacytidine-Induced Protein 1 (AZI1) Antibody
abx230757 100 µg

5-Azacytidine-Induced Protein 1 (AZI1) Antibody

Sign In for Pricing
View Details
Recombinant Human TRPV1 Protein, N-His
orb2967590-01 50 µg

Recombinant Human TRPV1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRPV1 Protein, N-His
orb2967590-02 100 µg

Recombinant Human TRPV1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRPV1 Protein, N-His
orb2967590-03 1 mg

Recombinant Human TRPV1 Protein, N-His

Sign In for Pricing
View Details
RPS10P27 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV782878 1.0 µg DNA

RPS10P27 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-LAMP2 Antibody Picoband® Fluoro488 Conjugated
A01573-3-Fluoro488 100 µg/Vial

Anti-LAMP2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details