Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64D IGHV3-64D

UniProt

A0A0J9YX35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RH1 Polyclonal Antibody
MBS7197186 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RH1 Polyclonal Antibody

Sign In for Pricing
View Details
Human Vaccinia Related Kinase 1 (VRK1) ELISA Kit
EKU08068 96 Tests

Human Vaccinia Related Kinase 1 (VRK1) ELISA Kit

Sign In for Pricing
View Details
Human EYA2 qPCR Primer Pair
QH13969S 200 Tests

Human EYA2 qPCR Primer Pair

Sign In for Pricing
View Details
Krtap20-2 (NM_001163615) Mouse Tagged ORF Clone
MG215183 10 µg

Krtap20-2 (NM_001163615) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human METTL7B Protein - (Dry Ice)
H00196410-P01-10ug 10 µg

Recombinant Human METTL7B Protein - (Dry Ice)

Sign In for Pricing
View Details
CO040 Rabbit Polyclonal Antibody
BT-AP08176-01 20 µL

CO040 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details