Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64D IGHV3-64D

UniProt

A0A0J9YX35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E) -5-Methoxy-3- ((3- ((E) -2- (6- (4-methylpiperazin-1-yl) pyridin-3-yl) vinyl) -1H-indazol-6-yl) methylene) indolin-2-one dihydrochloride
TWB72282-01 5 mg

(E) -5-Methoxy-3- ((3- ((E) -2- (6- (4-methylpiperazin-1-yl) pyridin-3-yl) vinyl) -1H-indazol-6-yl) methylene) indolin-2-one dihydrochloride

Sign In for Pricing
View Details
(E) -5-Methoxy-3- ((3- ((E) -2- (6- (4-methylpiperazin-1-yl) pyridin-3-yl) vinyl) -1H-indazol-6-yl) methylene) indolin-2-one dihydrochloride
TWB72282-02 10 mg

(E) -5-Methoxy-3- ((3- ((E) -2- (6- (4-methylpiperazin-1-yl) pyridin-3-yl) vinyl) -1H-indazol-6-yl) methylene) indolin-2-one dihydrochloride

Sign In for Pricing
View Details
(E) -5-Methoxy-3- ((3- ((E) -2- (6- (4-methylpiperazin-1-yl) pyridin-3-yl) vinyl) -1H-indazol-6-yl) methylene) indolin-2-one dihydrochloride
TWB72282-03 25 mg

(E) -5-Methoxy-3- ((3- ((E) -2- (6- (4-methylpiperazin-1-yl) pyridin-3-yl) vinyl) -1H-indazol-6-yl) methylene) indolin-2-one dihydrochloride

Sign In for Pricing
View Details
(E) -5-Methoxy-3- ((3- ((E) -2- (6- (4-methylpiperazin-1-yl) pyridin-3-yl) vinyl) -1H-indazol-6-yl) methylene) indolin-2-one dihydrochloride
TWB72282-04 50 mg

(E) -5-Methoxy-3- ((3- ((E) -2- (6- (4-methylpiperazin-1-yl) pyridin-3-yl) vinyl) -1H-indazol-6-yl) methylene) indolin-2-one dihydrochloride

Sign In for Pricing
View Details
CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)
orb2703656-01 1 mg

CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)

Sign In for Pricing
View Details
CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)
orb2703656-02 5 mg

CEACAM5 (Immunomedics patent Class III) Biosimilar (CEACAM5 / CEA / CD66e Reference Antibody)

Sign In for Pricing
View Details