Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-10-1 IGHV5-10-1

UniProt

A0A0J9YXX1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NKCC1/SLC12A2 Antibody Picoband®, Carrier-free
A03603-carrier-free 100 µg/Vial

Anti-NKCC1/SLC12A2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
ALDH1A2 Protein Vector (Human) (pPM-C-HA)
PV001299 500 ng

ALDH1A2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
3- (3-Bromo-2-methylphenyl) propanoic acid
DLB55747-01 50 mg

3- (3-Bromo-2-methylphenyl) propanoic acid

Sign In for Pricing
View Details
3- (3-Bromo-2-methylphenyl) propanoic acid
DLB55747-02 0.5 g

3- (3-Bromo-2-methylphenyl) propanoic acid

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF594 conjugate, 0.1mg/mL
BNC942923-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AACT Rabbit Polyclonal Antibody (PE-Cy5.5)
orb918158 100 µL

AACT Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details