Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-2 (TVB62), Biotinylated

This Recombinant Human T cell receptor beta variable 6-2 (TVB62), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-2 TRBV6-2

UniProt

A0A0J9YXY3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xylazine-Fluorescein Conjugate
50616-AAT 1 mg

Xylazine-Fluorescein Conjugate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702046 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Dag1 Mouse Gene Knockout Kit (CRISPR)
KN304265RB 1 Kit

Dag1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Delmadinone Acetate
TRC-D230665-5MG 5 mg

Delmadinone Acetate

Sign In for Pricing
View Details
Skil Mouse Gene Knockout Kit (CRISPR)
KN515824 1 Kit

Skil Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Bub3 activation kit by CRISPRa
GA200455 1 Kit

Mouse Bub3 activation kit by CRISPRa

Sign In for Pricing
View Details