Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-1 (TVBK1), Biotinylated

This Recombinant Human T cell receptor beta variable 11-1 (TVBK1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-1 TRBV11-1

UniProt

A0A0K0K1C0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Duodenum
CS627257 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details
BACE1 Human Knockdown Lysate
LY300499 100 µg

BACE1 Human Knockdown Lysate

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), CF488A conjugate, 0.1mg/mL
BNC881730-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caspase-3 Microplate Assay Kit
RDSM194 100 Assays

Caspase-3 Microplate Assay Kit

Sign In for Pricing
View Details
IRAK (IRAK1) Rabbit Polyclonal Antibody
TA371923 100 µL

IRAK (IRAK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF740 conjugate, 0.1mg/mL
BNC743732-100 1x 100 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details