Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-1 (TVBK1), Biotinylated

This Recombinant Human T cell receptor beta variable 11-1 (TVBK1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-1 TRBV11-1

UniProt

A0A0K0K1C0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike RBD-SD1 (W436R) (His Tag)
PKSV030385 500 µg

Recombinant SARS-CoV-2 Spike RBD-SD1 (W436R) (His Tag)

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF647 conjugate, 0.1mg/mL
BNC473433-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zinc-Copper Couple
TRC-Z439000-50G 50 g

Zinc-Copper Couple

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (rAE-4), CF647 conjugate, 0.1mg/mL
BNC473518-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (rAE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CCT2 Antibody
RC-16036-01 50 μL

Recombinant CCT2 Antibody

Sign In for Pricing
View Details
Recombinant CCT2 Antibody
RC-16036-02 100 µL

Recombinant CCT2 Antibody

Sign In for Pricing
View Details