Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-1 (TVBK1), Biotinylated

This Recombinant Human T cell receptor beta variable 11-1 (TVBK1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-1 TRBV11-1

UniProt

A0A0K0K1C0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVAQSPRYKITEKSQAVAFWCDPISGHATLYWYRQILGQGPELLVQFQDESVVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SGPP1 shRNA Plasmid
abx979092-01 150 µg

Mouse SGPP1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SGPP1 shRNA Plasmid
abx979092-02 300 µg

Mouse SGPP1 shRNA Plasmid

Sign In for Pricing
View Details
OR9G3P Protein Lysate (Human) with C-Ha Tag
35703031 100 µg

OR9G3P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PRMT10 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37715124 3x 1.0µg DNA

PRMT10 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Human Two pore calcium channel protein 2 ELISA Kit
MBS2887857-01 48 Well

Human Two pore calcium channel protein 2 ELISA Kit

Sign In for Pricing
View Details
Human Two pore calcium channel protein 2 ELISA Kit
MBS2887857-02 96 Well

Human Two pore calcium channel protein 2 ELISA Kit

Sign In for Pricing
View Details