Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 27 (TVB27), Biotinylated

This Recombinant Human T cell receptor beta variable 27 (TVB27), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 27 TRBV27

UniProt

A0A0K0K1C4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGYKVSRKEKRNFPLILESPSPNQTSLYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arg2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3855308 1.0 µg DNA

Arg2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-Clathrin heavy-chain 1,2
AS10 690 50 µg

Anti-Clathrin heavy-chain 1,2

Sign In for Pricing
View Details
DprE1-IN-13
T205123-01 10 mg

DprE1-IN-13

Sign In for Pricing
View Details
DprE1-IN-13
T205123-02 50 mg

DprE1-IN-13

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum CARP Protein (aa 1-443) (E. coli)
VAng-Wyb6374-inquire Inquire

Recombinant Plasmodium Falciparum CARP Protein (aa 1-443) (E. coli)

Sign In for Pricing
View Details
THSD7B Adenovirus (Mouse)
46677054 1.0 mL

THSD7B Adenovirus (Mouse)

Sign In for Pricing
View Details