Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61), Biotinylated

This Recombinant Human T cell receptor beta variable 6-1 (TVB61), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QTRT1, CT (QTRT1, TGT, TGUT, Queuine tRNA-ribosyltransferase, Guanine insertion enzyme, tRNA-guanine transglycosylase) (Azide free) (HRP) discontinued
040726-HRP 200 µL

QTRT1, CT (QTRT1, TGT, TGUT, Queuine tRNA-ribosyltransferase, Guanine insertion enzyme, tRNA-guanine transglycosylase) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
pECMV-Klra7-m-FLAG Plasmid
PVT15490 2 µg

pECMV-Klra7-m-FLAG Plasmid

Sign In for Pricing
View Details
Anti Chicken IgG (IgY)
SA0024 100 µL

Anti Chicken IgG (IgY)

Sign In for Pricing
View Details
AGPAT5 Antibody
orb1335336 100 µg

AGPAT5 Antibody

Sign In for Pricing
View Details
Olfr313 siRNA Oligos set (Mouse)
33061174 3x 5 nmol

Olfr313 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Polyclonal Antibody to Cytochrome P450 Reductase (CPR)
MBS2028728-01 0.1 mL

Polyclonal Antibody to Cytochrome P450 Reductase (CPR)

Sign In for Pricing
View Details