Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61), Biotinylated

This Recombinant Human T cell receptor beta variable 6-1 (TVB61), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bet1l (NM_019368) Rat Untagged Clone
RN211912 10 µg

Bet1l (NM_019368) Rat Untagged Clone

Sign In for Pricing
View Details
NP-1 (alpha Defensin-1, DEF1, DEFA1, DEFA2, HNP-1, HP1, HP-1, MGC138393, MRS) (HRP) discontinued
N5377-01B-HRP 100 µL

NP-1 (alpha Defensin-1, DEF1, DEFA1, DEFA2, HNP-1, HP1, HP-1, MGC138393, MRS) (HRP) discontinued

Sign In for Pricing
View Details
Hps5 (NM_001005247) Mouse Tagged Lenti ORF Clone
MR221109L3 10 µg

Hps5 (NM_001005247) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Hamster Prekallikrein ELISA Kit
MBS061027-01 48 Well

Hamster Prekallikrein ELISA Kit

Sign In for Pricing
View Details
Hamster Prekallikrein ELISA Kit
MBS061027-02 96 Well

Hamster Prekallikrein ELISA Kit

Sign In for Pricing
View Details
Hamster Prekallikrein ELISA Kit
MBS061027-03 5x 96 Well

Hamster Prekallikrein ELISA Kit

Sign In for Pricing
View Details