Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61), Biotinylated

This Recombinant Human T cell receptor beta variable 6-1 (TVB61), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM63B siRNA (h)
sc-90248 10 µM

FAM63B siRNA (h)

Sign In for Pricing
View Details
Brady M21-750-499 label
LAB6147 1 Each

Brady M21-750-499 label

Sign In for Pricing
View Details
UNC2881
S7325-1g 1 g

UNC2881

Sign In for Pricing
View Details
PLV3-U6-RARRES2-shRNA2-CopGFP-Puro Plasmid
PVT74493 2 µg

PLV3-U6-RARRES2-shRNA2-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
9- (3-bromo-5-chlorophenyl) phenanthrene
JH920096 1 Each

9- (3-bromo-5-chlorophenyl) phenanthrene

Sign In for Pricing
View Details
Mouse Monoclonal p53 Antibody (rTP53/8063) [DyLight 350]
NBP3-24174UV 0.1 mL

Mouse Monoclonal p53 Antibody (rTP53/8063) [DyLight 350]

Sign In for Pricing
View Details