Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77), Biotinylated

This Recombinant Human T cell receptor beta variable 7-7 (TVB77), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dcaf15 Rat siRNA Oligo Duplex (Locus ID 304653)
SR507693 1 Kit

Dcaf15 Rat siRNA Oligo Duplex (Locus ID 304653)

Sign In for Pricing
View Details
DNAJC21 Antibody
DF12950-01 100 µL

DNAJC21 Antibody

Sign In for Pricing
View Details
DNAJC21 Antibody
DF12950-02 200 µL

DNAJC21 Antibody

Sign In for Pricing
View Details
PROKR2 Antibody
MBS9406324-01 0.1 mL

PROKR2 Antibody

Sign In for Pricing
View Details
PROKR2 Antibody
MBS9406324-02 5x 0.1 mL

PROKR2 Antibody

Sign In for Pricing
View Details
ZNF789 Protein Lysate
OCOA03423-20UG 20 µg

ZNF789 Protein Lysate

Sign In for Pricing
View Details