Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3), Biotinylated

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,6-Diphenylphenol
TRC-D492230-250MG 250 mg

2,6-Diphenylphenol

Sign In for Pricing
View Details
Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Over-expression Lysate
LC400951 20 µg

Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Over-expression Lysate

Sign In for Pricing
View Details
CRKL pTyr207 Rabbit Polyclonal Antibody
AP20935PU-N 100 µg

CRKL pTyr207 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF732 Human Gene Knockout Kit (CRISPR)
KN426521 1 Kit

ZNF732 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLAUR (NM_001005377) Human Over-expression Lysate
LC423710 20 µg

PLAUR (NM_001005377) Human Over-expression Lysate

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF647 conjugate, 0.1mg/mL
BNC470485-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details