Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3), Biotinylated

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Elob qPCR Primer Pair
QM34706S 200 Tests

Mouse Elob qPCR Primer Pair

Sign In for Pricing
View Details
PLEKHO2 antibody
FNab06544 100 µg

PLEKHO2 antibody

Sign In for Pricing
View Details
Lentiviral mouse Mcoln1 shRNA (UAS) - Lentiviral mouse Mcoln1 shRNA (UAS, iRFP) plasmid
GTR15265804 1 Vial

Lentiviral mouse Mcoln1 shRNA (UAS) - Lentiviral mouse Mcoln1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Monoclonal Villin 1 Antibody (VIL1/4107R) [DyLight 405]
NBP3-08935V 100 µL

Rabbit Monoclonal Villin 1 Antibody (VIL1/4107R) [DyLight 405]

Sign In for Pricing
View Details
EXOC2 AAV Vector (Mouse) (CMV)
19559104 1 µg

EXOC2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Cdk2 Polyclonal Antibody
MBS8521813-01 0.1 mg

Cdk2 Polyclonal Antibody

Sign In for Pricing
View Details