Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-2 (TVBJ2), Biotinylated

This Recombinant Human T cell receptor beta variable 10-2 (TVBJ2), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-2 TRBV10-2

UniProt

A0A0K0K1G8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC119B (C-term) Rabbit Polyclonal Antibody
AP54431PU-N 400 µL

UNC119B (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF568 conjugate, 0.1mg/mL
BNC682123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), Biotin conjugate, 0.1mg/mL
BNCB0280-500 1x 500 µL

Glycophorin A / CD235a (GYPA/280), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycyl-D-phenylalanine
TRC-A350543-50MG 50 mg

Glycyl-D-phenylalanine

Sign In for Pricing
View Details
RUNX2 Human Gene Knockout Kit (CRISPR)
KN212884RB 1 Kit

RUNX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), 0.2mg/mL
BNUB1921-500 1x 500 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), 0.2mg/mL

Sign In for Pricing
View Details