Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM237A (F237A), Biotinylated

This Recombinant Human Protein FAM237A (F237A), Biotinylated spans the amino acid sequence from region 34-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM237A FAM237A

UniProt

A0A1B0GTK4

Expression Region

34-113

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HSQTDLLALSQADPQCWESSSVLLLEMWKPRVSNTVSGFWDFMIYLKSSENLKHGALFWDLAQLFWDIYVDCVLSRNHGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD2, CT (KCTD2, KIAA0176, BTB/POZ domain-containing protein KCTD2, Potassium channel tetramerization domain-containing protein 2) (MaxLight 750)
MBS6312883-01 0.1 mL

KCTD2, CT (KCTD2, KIAA0176, BTB/POZ domain-containing protein KCTD2, Potassium channel tetramerization domain-containing protein 2) (MaxLight 750)

Sign In for Pricing
View Details
KCTD2, CT (KCTD2, KIAA0176, BTB/POZ domain-containing protein KCTD2, Potassium channel tetramerization domain-containing protein 2) (MaxLight 750)
MBS6312883-02 5x 0.1 mL

KCTD2, CT (KCTD2, KIAA0176, BTB/POZ domain-containing protein KCTD2, Potassium channel tetramerization domain-containing protein 2) (MaxLight 750)

Sign In for Pricing
View Details
Claudin18.2 IHC 3B10 Kit
CAA-B002-30ml 30 mL

Claudin18.2 IHC 3B10 Kit

Sign In for Pricing
View Details
Rabbit Anti-LRC59/LRRC59 Polyclonal Antibody
PAV8669 100 μL

Rabbit Anti-LRC59/LRRC59 Polyclonal Antibody

Sign In for Pricing
View Details
ATP13A4 ORF Vector (Human) (pORF)
12667011 1.0 µg DNA

ATP13A4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human GPR35 (G-protein coupled receptor 35) QuickTest ELISA Kit
MBS7618983-01 48 Well

Human GPR35 (G-protein coupled receptor 35) QuickTest ELISA Kit

Sign In for Pricing
View Details