Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM237B (F237B), Biotinylated

This Recombinant Human Protein FAM237B (F237B), Biotinylated spans the amino acid sequence from region 25-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM237B FAM237B

UniProt

A0A1B0GVD1

Expression Region

25-112

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DFEFQKGVLASISPGITKDIDLQCWKACSLTLIDLKELKIEHNVDAFWNFMLFLQKSQRPGHYNVFLNIAQDFWDMYVDCLLSRSHGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microscope Slides Nostoc Heterocyst
4041300/2 1 Each

Microscope Slides Nostoc Heterocyst

Sign In for Pricing
View Details
TR150 Polyclonal Antibody
E11-200162 100 µg -100 µL

TR150 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SMAD1 Antibody
CQA0488-01 30 µL

Anti-SMAD1 Antibody

Sign In for Pricing
View Details
Anti-SMAD1 Antibody
CQA0488-02 50 μL

Anti-SMAD1 Antibody

Sign In for Pricing
View Details
Anti-SMAD1 Antibody
CQA0488-03 100 µL

Anti-SMAD1 Antibody

Sign In for Pricing
View Details
Anti-SMAD1 Antibody
CQA0488-04 200 µL

Anti-SMAD1 Antibody

Sign In for Pricing
View Details