Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated

This Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2A7 (NM_000764) Human Mass Spec Standard
PH313527 10 µg

CYP2A7 (NM_000764) Human Mass Spec Standard

Sign In for Pricing
View Details
Ultrapure Nuclease-Free Water - 100 mL
28014 1 Unit

Ultrapure Nuclease-Free Water - 100 mL

Sign In for Pricing
View Details
CAPNS1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
15002151 3x 1.0 µg DNA

CAPNS1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g48840 Polyclonal Antibody
MBS9011733 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g48840 Polyclonal Antibody

Sign In for Pricing
View Details
PRTG Rabbit Polyclonal Antibody (BF750)
orb2469344 100 µL

PRTG Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
pCR4-TOPO-CCL7 Plasmid
PVT28594 2 µg

pCR4-TOPO-CCL7 Plasmid

Sign In for Pricing
View Details