Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated

This Recombinant Human T cell receptor beta variable 7-6 (TVB76), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Furoic acid hydrazide
276028-01 25 g

2-Furoic acid hydrazide

Sign In for Pricing
View Details
2-Furoic acid hydrazide
276028-02 50 g

2-Furoic acid hydrazide

Sign In for Pricing
View Details
2-Furoic acid hydrazide
276028-03 100 g

2-Furoic acid hydrazide

Sign In for Pricing
View Details
2-Furoic acid hydrazide
276028-04 250 g

2-Furoic acid hydrazide

Sign In for Pricing
View Details
2-Furoic acid hydrazide
276028-05 500 g

2-Furoic acid hydrazide

Sign In for Pricing
View Details
M27,3′-OGP3G (ARCA Cap Analog) (5 mg)
JBS-NU-855-5 5 mg

M27,3′-OGP3G (ARCA Cap Analog) (5 mg)

Sign In for Pricing
View Details