Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated

This Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEF1 Mouse Monoclonal Antibody [Clone ID: OTI10A7]
CF812988 100 µg

LEF1 Mouse Monoclonal Antibody [Clone ID: OTI10A7]

Sign In for Pricing
View Details
IKK gamma (IKBKG) (NM_001099857) Human Over-expression Lysate
LY420210 100 µg

IKK gamma (IKBKG) (NM_001099857) Human Over-expression Lysate

Sign In for Pricing
View Details
Srgap3 Mouse Gene Knockout Kit (CRISPR)
KN516712 1 Kit

Srgap3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Creatine Kinase-BB (CK-BB) (CKBB/1268), CF640R conjugate, 0.1mg/mL
BNC401268-100 1x 100 µL

Creatine Kinase-BB (CK-BB) (CKBB/1268), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Neuroglobin (NGB) activation kit by CRISPRa
GA111754 1 Kit

Human Neuroglobin (NGB) activation kit by CRISPRa

Sign In for Pricing
View Details
ROR2 (ROR2/1911), CF488A conjugate, 0.1mg/mL
BNC881911-500 1x 500 µL

ROR2 (ROR2/1911), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details