Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated

This Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: sigmoid
CS646685 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
Dnmt2 (TRDMT1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H10]
TA811494BM 100 µL

Dnmt2 (TRDMT1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H10]

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (79-430) Mouse Monoclonal Antibody [Clone ID: AT2G3]
AM09381PU-S 50 µL

Cytokeratin 18 (KRT18) (79-430) Mouse Monoclonal Antibody [Clone ID: AT2G3]

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), Biotin conjugate, 0.1mg/mL
BNCB1961-500 1x 500 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CD5 Antibody
RC-15656-01 50 μL

Recombinant CD5 Antibody

Sign In for Pricing
View Details
Recombinant CD5 Antibody
RC-15656-02 100 µL

Recombinant CD5 Antibody

Sign In for Pricing
View Details