Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated

This Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSV-g Epitope Tag (YTDIEMNRLGK) Rabbit Polyclonal Antibody
AP11022PU-N 400 µL

VSV-g Epitope Tag (YTDIEMNRLGK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hexabutylditin
TRC-H290128-50MG 50 mg

Hexabutylditin

Sign In for Pricing
View Details
beta Catenin (CTNNB1) (C-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 10H8]
AM00022PU-N 100 µg

beta Catenin (CTNNB1) (C-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 10H8]

Sign In for Pricing
View Details
Human FNDC8 activation kit by CRISPRa
GA110241 1 Kit

Human FNDC8 activation kit by CRISPRa

Sign In for Pricing
View Details
BMP 7 Human
OM296904-01 10 µg

BMP 7 Human

Sign In for Pricing
View Details
BMP 7 Human
OM296904-02 2 µg

BMP 7 Human

Sign In for Pricing
View Details