Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated

This Recombinant Human T cell receptor beta variable 7-8 (TVB78), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ILF3 Antibody (0S2N7)
NBP3-16664-20ul 20 µL

Rabbit Monoclonal ILF3 Antibody (0S2N7)

Sign In for Pricing
View Details
DNMT3L Antibody
orb1273894 0.5 mg

DNMT3L Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Fc gamma RIIA/CD32a Antibody (FCGR2A/479) [FITC]
NBP3-08220F 100 µL

Mouse Monoclonal Fc gamma RIIA/CD32a Antibody (FCGR2A/479) [FITC]

Sign In for Pricing
View Details
S100A10 Recombinant Antibody, Cy7 Conjugated
bsm-61398R-Cy7-TR 20 µL

S100A10 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
NOX4 Antibody
MBS8501190-01 0.1 mL

NOX4 Antibody

Sign In for Pricing
View Details
NOX4 Antibody
MBS8501190-02 0.1 mL (AF405L)

NOX4 Antibody

Sign In for Pricing
View Details