Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5), Biotinylated

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FSTL3 (Follistatin Like Protein 3) ELISA Kit
E-EL-H6294-01 24 Tests

Human FSTL3 (Follistatin Like Protein 3) ELISA Kit

Sign In for Pricing
View Details
Human FSTL3 (Follistatin Like Protein 3) ELISA Kit
E-EL-H6294-02 48 Tests

Human FSTL3 (Follistatin Like Protein 3) ELISA Kit

Sign In for Pricing
View Details
Human FSTL3 (Follistatin Like Protein 3) ELISA Kit
E-EL-H6294-03 96 Tests

Human FSTL3 (Follistatin Like Protein 3) ELISA Kit

Sign In for Pricing
View Details
Cops2 Mouse Gene Knockout Kit (CRISPR)
KN503682 1 Kit

Cops2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF740 conjugate, 0.1mg/mL
BNC741824-500 1x 500 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Clk1 Mouse Gene Knockout Kit (CRISPR)
KN503469 1 Kit

Clk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details